PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100221890032
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 407aa    MW: 45426.5 Da    PI: 8.3803
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100221890032genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.98.1e-27123176155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+++ WtpeLH+rFv aveqL G++kA+P++ile+m+v +Lt+++++SHLQkYR+
  Ote100221890032|100221890032 123 KAKVGWTPELHRRFVTAVEQL-GIDKAVPSRILEIMGVACLTRHNIASHLQKYRS 176
                                   67899****************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.76120179IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-27120180IPR009057Homeodomain-like
SuperFamilySSF466892.51E-17121179IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-25123177IPR006447Myb domain, plants
PfamPF002494.7E-6127175IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MLAVKSERNE GESEMRGFSV EENEFVGGED LLDAIDFDGF FAGFSDGDVL PDLEMDHEAV  60
AELSSSESEN KSGKSENAAP DSDVGLESPV KIPEKETVST MAEPESVRNR ASKEAERSGK  120
KKKAKVGWTP ELHRRFVTAV EQLGIDKAVP SRILEIMGVA CLTRHNIASH LQKYRSQRKH  180
LQAREAEAAR WSRRRQIYGS ATAPTQLNHW IAPAMGFPPV TPVPHYRPLH VWGHPSVDQS  240
LMYTWPKHVA PPSHAWPPPL ADPSFWHPPH PYTFPPAAAA GGDAPTAQTV PRTACDVHPV  300
IFILLHKLYA FELRLKNRII EGEYRCSHRR RNNKAMVAAA IGAKATVYGQ CDTRTTTPRR  360
IENTSNLTIY LLINQLLASP SLRKINCELE IHKNANICEF ASTKKRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-14121175357ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100244.11e-86PREDICTED: probable transcription factor GLK1
SwissprotQ9SIV32e-64GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A061E3A46e-81A0A061E3A4_THECC; GBF's pro-rich region-interacting factor 1
STRINGGLYMA13G37010.12e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356